PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10031281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 333aa    MW: 37230.6 Da    PI: 6.5068
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10031281genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.6e-152168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l  +    G g+W+ +ar  g+ R++k+c++rw +yl
      Lus10031281 21 KGLWSPEEDEKLMSYMMNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 68
                     678*******************************************97 PP

2Myb_DNA-binding52.98.6e-1774117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+v+++ +lG++ W+ Ia++++ gRt++++k++w++
      Lus10031281  74 RGAFSPQEEELIVHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 117
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.211668IPR017930Myb domain
SuperFamilySSF466894.69E-2819115IPR009057Homeodomain-like
SMARTSM007171.9E-102070IPR001005SANT/Myb domain
PfamPF002497.3E-142168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-232275IPR009057Homeodomain-like
CDDcd001673.20E-92468No hitNo description
PROSITE profilePS5129425.55269123IPR017930Myb domain
SMARTSM007176.9E-1673121IPR001005SANT/Myb domain
PfamPF002492.6E-1574117IPR001005SANT/Myb domain
CDDcd001671.55E-1176119No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2576124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MRKPTEPTSG NTTTAMVKLR KGLWSPEEDE KLMSYMMNNG QGCWSDVARN AGLQRCGKSC  60
RLRWINYLRP DLKRGAFSPQ EEELIVHLHS LLGNRWSQIA ARLPGRTDNE IKNFWNSTVK  120
KRLKNIQSSS ASPNTSDSSS DHQPVGSKDH NAMIGLSSSS PLNFMPSPMF MVDPSLTSTT  180
TNHIMDPNSS QILDHHPNHH HGLMMNNMYG ANNVSLYFDS HMASNIPPPR MGSKQDMFAV  240
GGGGGGNGEL QVIPPLMEET MNGANETNLT TNCNNNKYPF VSSNTIKEEI NDTNLGNYWQ  300
GDHHHQDRVG EWDFEELMKD VSCFPFLDFQ VE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-271912325128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8874621e-115HQ887462.1 Linum usitatissimum clone GMU2AYZ01BW4NE microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015571138.11e-101PREDICTED: transcription factor MYB46
SwissprotQ9LXV22e-70MYB46_ARATH; Transcription factor MYB46
TrEMBLS5XGT46e-99S5XGT4_POPTR; MYB transcription factor
STRINGPOPTR_0009s05860.12e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.12e-72myb domain protein 83